The domain within your query sequence starts at position 116 and ends at position 181; the E-value for the DUF3719 domain shown below is 1.5e-28.

LLYEQQLSAHTQGLQKECQQWAASFPHLRILGRQIITPSEGYGLYPRSPSAVSASHEATL
SQERES

DUF3719

DUF3719
PFAM accession number:PF12516
Interpro abstract (IPR022194):

This domain is found in eukaryotes, and is approximately 70 amino acids in length. There is a conserved HLR sequence motif. There are two completely conserved residues (W and H) that may be functionally important.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3719