The domain within your query sequence starts at position 116 and ends at position 183; the E-value for the DUF3719 domain shown below is 2.2e-25.
LLYEQQLSAHTQGLQKECQQWAASFPHLRILGRQIITPSEGYGLYPRSPSAVSASHEATL SQERESTM
DUF3719 |
---|
PFAM accession number: | PF12516 |
---|---|
Interpro abstract (IPR022194): | This domain is found in eukaryotes, and is approximately 70 amino acids in length. There is a conserved HLR sequence motif. There are two completely conserved residues (W and H) that may be functionally important. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3719