The domain within your query sequence starts at position 742 and ends at position 883; the E-value for the DUF3736 domain shown below is 9.7e-46.
QRRKLVSKLDLEERRRREAQEKGYYYDLDDSYDESDEEEVRAHLRCVAEQPPLKLDTSSE KLEFLQLFGLTTQQQKEELVAQKRRKRRRMLRERSPSPPAVQCKRQTPSPRLALSTRYSP DEMNNSPNFEEKRKFLTFFNLT
DUF3736 |
---|
PFAM accession number: | PF12540 |
---|---|
Interpro abstract (IPR022207): | This domain is found in genetic suppressor element coiled-coil proteins. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3736