The domain within your query sequence starts at position 532 and ends at position 670; the E-value for the DUF3740 domain shown below is 1.3e-46.
YKTSYARNRSIRSVAIEVDGEIYHVGLDTVPQPRNLSKPHWPGAPEDQDDKDGGSFSGTG GLPDYSAPNPIKVTHRCYILENDTVQCDLDLYKSLQAWKDHKLHIDHEIETLQNKIKNLR EVRGHLKKKRPEECDCHRI
DUF3740 |
---|
PFAM accession number: | PF12548 |
---|---|
Interpro abstract (IPR024609): | This uncharacterised domain is found in the C-terminal region of extracellular sulphatase proteins. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3740