The domain within your query sequence starts at position 202 and ends at position 338; the E-value for the DUF3752 domain shown below is 8.9e-25.
PPEMKEFGLGPRTFKRRADDKSGDRSVWTDTPADRERKAKEIQEARKSFSKKDEENILSG RDKRLAEQVSSYNESKRSESLMDIHHKKLKSKAAEDKNKHQERIPFDRDKDLKVNRFDEA QKKALIKKSRELNTRFS
DUF3752 |
---|
PFAM accession number: | PF12572 |
---|---|
Interpro abstract (IPR022226): | This domain family is found in eukaryotes, and is typically between 140 and 163 amino acids in length. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3752