The domain within your query sequence starts at position 182 and ends at position 349; the E-value for the DUF3754 domain shown below is 3.6e-12.
DEVQVTINLDQYIYIQFWALGQRVGQMPHKSSVGSKRGFFRKLPPVERRYFKRVVLAART KGGHLVLKSFKDTPLEGLEQLLPELKVRTPVLQRALLNLMLVVSGVMIFVNVGMVILSDL KMATSLLLLLFAAFMGVKASKVFGQRRSAQALELAHVLYYRSTSNNSE
DUF3754 |
---|
PFAM accession number: | PF12576 |
---|---|
Interpro abstract (IPR022227): | This domain family is found in bacteria, archaea and eukaryotes, and is typically between 135 and 166 amino acids in length. There is a single completely conserved residue P that may be functionally important. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3754