The domain within your query sequence starts at position 221 and ends at position 344; the E-value for the DUF3754 domain shown below is 3.8e-12.

PVERRYFKRVVLAARTKGGHLVLKSFKDTPLEGLEQLLPELKVRTPVLQRALLNLMLVVS
GVMIFVNVGMVILSDLKMATSLLLLLFAAFMGVKASKVFGQRRSAQALELAHVLYYRSTS
NNSE

DUF3754

• PFAM accession number: PF12576
• Interpro abstract (IPR022227):

  This domain family is found in bacteria, archaea and eukaryotes, and is typically between 135 and 166 amino acids in length. There is a single completely conserved residue P that may be functionally important.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3754