The domain within your query sequence starts at position 69 and ends at position 522; the E-value for the DUF3808 domain shown below is 7.2e-150.

TTGLYLFLNNRFSDAINLIHPWSKNSSYHALIYSMFMVVKAILTFEPQDIQIGMNAAKEA
LKTCNNFRKKPRIVTLSRLMSRQGIKSIKEEELHAEVCYAECLVLKSAITFIQDDSLLSF
LKSGVNVGSSYQIYKDCQQVLELMPENQSKTHRHLIGGIKFGVGVFNLMFSLVPPKSLKL
LNMVGYSGDREVGLALLHDSASEPHINNILSVFTLLFYYNYVRVVVGVEKASTAATESLF
LIYLEKFPNCVVLKFFRARFNMLNGNFESAKLKLQECIITQNEWKQVHHLCYWELMWCHI
FLQNWKQAYNYASLLFQHSRWSKAIYIYSKAIILALIPPDCVDSENESLSSYFLRVDSLR
IKILGSSVPIEKFIAEKSQRYGTTTGWFTAQPLLEFIYAWSGFRVMSKKIELISSWLLII
DKGKELLSENPNEEYGIDDMSLLNLLKGLCLKHL

DUF3808

DUF3808
PFAM accession number:PF10300
Interpro abstract (IPR019412):

This entry represents a family of proteins conserved from fungi to humans, including fungal Iml2 protein, animal tetratricopeptide repeat protein 39A/B/C (TT39A/B/C) and some characterised proteins. Members of this family carry a tetratricopeptide repeat (IPR013105) at their C terminus.

In Saccharomyces cerevisiae, Iml2 and its paralogue-YKR018C are included in this entry. Iml2 localises to the cytoplasm and nucleus [(PUBMED:14562095)], and its expression is increased in response to DNA replication stress [(PUBMED:22842922)]. It is found to be involved in lipid droplet-mediated inclusion body clearing after protein folding stress [(PUBMED:26004510)].

In humans TTC39A (also known as DEME6) is expressed in primary breast carcinomas but not in normal breast tissue, and has a putative eukaryotic RNP-1 RNA binding region and a candidate anchoring transmembrane domain. It is coordinately regulated with oestrogen receptor, but is not necessarily oestradiol-responsive [(PUBMED:9461476)]. TTC39B has been linked to lipid metabolism [(PUBMED:20686565), (PUBMED:21738485)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3808