The domain within your query sequence starts at position 1387 and ends at position 1534; the E-value for the DUF3819 domain shown below is 2.3e-57.

PQLKQCVRQAIERAVQELVHPVVDRSIKIAMTTCEQIVRKDFALDSEESRMRIAAHHMMR
NLTAGMAMITCREPLLMSISTNLKNSFASALRTASPQQREMMDQAAAQLAQDNCELACCF
IQKTAVEKAGPEMDKRLATEFELRKHAR

DUF3819

DUF3819
PFAM accession number:PF12842
Interpro abstract (IPR024557):

The Ccr4-Not complex is a global regulator of gene expression that is conserved from yeast to human. It affects genes positively and negatively and is thought to regulate transcription factor IID function. In Saccharomyces cerevisiae, it exists in two prominent forms and consists of at least nine core subunits: the five Not proteins (Not1p to Not5p), Caf1p, Caf40p, Caf130p and Ccr4p [(PUBMED:10637334)]. The Ccr4-Not complex regulates many different cellular functions, including RNA degradation and transcription initiation. It may be a regulatory platform that senses nutrient levels and stress [(PUBMED:12957374)]. Caf1p and Ccr4p, are directly involved in mRNA deadenylation, and Caf1p is associated with Dhh1p, a putative RNA helicase thought to be a component of the decapping complex [(PUBMED:11696541)]. Pop2, a component of the Ccr4-Not complex, functions as a deadenylase [(PUBMED:18430587)].

This entry represents a domain of unknown function found in the Not1 subunit of the CCR4-Not complex.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3819