The domain within your query sequence starts at position 453 and ends at position 579; the E-value for the DUF382 domain shown below is 2.9e-63.

ARPDVVEMHDVTAQDPKLLVHLKATRNSVPVPRHWCFKRKYLQGKRGIEKPPFELPDFIK
RTGIQEMREALQEKEEQKTMKSKMREKVRPKMGKIDIDYQKLHDAFFKWQTKPKLTIHGD
LYYEGKE

DUF382

DUF382
PFAM accession number:PF04037
Interpro abstract (IPR007180): This domain is specific to the human splicing factor 3b subunit 2 and its orthologs.
GO component:nucleus (GO:0005634)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF382