The domain within your query sequence starts at position 1026 and ends at position 1691; the E-value for the DUF3827 domain shown below is 7.1e-301.

SFLVPDPRFQVQTVLQFVPPSVDTGFCNFTQSIEKGLVTALFEVRKHQGTYNLTVQIVNV
TIASSRVAPRRGPVNIIFAVKGSQGFLNGSEVSDLLRNLTVVEFSFYLGYPVLQIAEPFQ
YPQLNLSQLLKSSWVRTVLLGVVEKQLHNEVFPAEMERKLAQLLSEVPTRRRVWRRATVA
AGNSVVQVVNVSRLEGDDNPVQLIYFVENQDGERLSAVKSSDLINKVDLQRAAIILGYRI
QGVIAQPVDRVKRPSPESQSNNLWVVVGVVIPVLVVTVIVVILYWKLCRTDKLDFQPDTV
ANIQQRQKLQIPSVKGFDFAKQHLGQHNKDDILIIHEPAPLPGPVKDHTTPSENGDVPSP
KSKLPSKNIRLRGRVSPSDADSTVSEESSERDAGEKAPAAAPENKALRAPQSGAPLPSSG
NEQHSSASIFEHVDRVSRTSEASRRVPSKIQLIAMQPIPAPPAQHPVLADRVAETNKINK
EIQSALRHKSEIEHHRNKIRLRAKRRGHYEFPVVDDLSSGDTKERHRVYRRAQMQIDKIL
DPAASVPSVFIEPRKSSRMKRSPKPRRKHQVNGCPADAEKDRLITTDSDGTYKRPPGVHN
SAYIGCPSDPDLPADVQTPSSTELGRYPGLPFSASQYIPPQPSIEEARQTMHSLLDDAFA
LVAPSS

DUF3827

DUF3827
PFAM accession number:PF12877
Interpro abstract (IPR024606):

The function of the proteins in this entry is not currently known, but one of the human proteins (Q9HCM3) has been implicated in pilocytic astrocytomas [(PUBMED:18974108), (PUBMED:19363522), (PUBMED:19937730)]. In the majority of cases of pilocytic astrocytomas a tandem duplication produces an in-frame fusion of the gene encoding this protein and the BRAF oncogene. The resulting fusion protein has constitutive BRAF kinase activity and is capable of transforming cells.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3827