The domain within your query sequence starts at position 421 and ends at position 602; the E-value for the DUF4042 domain shown below is 9.6e-73.

KVRQGALACFLSTIKSIEKKVLYGYWSAFVPDTPELGSPQSVSLMTLTLKDPSPKTRACA
LQVLSAILEGSKQFLSVAEDTSDHKRAFTPFSVTIASSIRELHRCLLLALVAESSSQTLT
QIIKCLANLVSNAPYNRLKLSLLTKVWNHIKPYIRHKDVNVRVSSLTLLGAIVSTHAPLP
EV

DUF4042

DUF4042
PFAM accession number:PF13251
Interpro abstract (IPR025283): This presumed domain is functionally uncharacterised.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4042