The domain within your query sequence starts at position 85 and ends at position 120; the E-value for the DUF4061 domain shown below is 1.1e-13.

VTDVYEMEGGLLNLLNDFHSGRLQAFAGACSGDAGE

DUF4061

DUF4061
PFAM accession number:PF13270
Interpro abstract (IPR025271):

This entry includes CCDC28A and CCDC28B. CCDC28B modulates mTORC2 complex assembly and function, possibly enhances AKT1 phosphorylation [ (PUBMED:23727834) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4061