The domain within your query sequence starts at position 85 and ends at position 185; the E-value for the DUF4061 domain shown below is 4.3e-45.

VTDVYEMEGGLLNLLNDFHSGRLQAFGKECSFEQLEHVREMQEKLARLHFSLDVCGEEED
EEEEEDGVTEGLPEEQKKTMADRNLDQLLSNLEDLSNSIQK

DUF4061

DUF4061
PFAM accession number:PF13270
Interpro abstract (IPR025271):

This presumed domain is functionally uncharacterised. There is a conserved AFG sequence motif.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4061