The domain within your query sequence starts at position 42 and ends at position 145; the E-value for the DUF4062 domain shown below is 1.5e-8.

RVFISANPEDTGAERQALRETVYPKLREFCRENYGLEFQVIDLYWGIEEDEWDSPELQKM
RMKLLEECLKTSAGPCFVGLLGEKYGNIRIPGEVEASEFEMILD

DUF4062

DUF4062
PFAM accession number:PF13271
Interpro abstract (IPR025139): This presumed domain is functionally uncharacterised.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4062