The domain within your query sequence starts at position 909 and ends at position 1020; the E-value for the DUF4062 domain shown below is 2.4e-22.
RLFISSTFRDMHGERDLLMRSVLPALQARVFPHRISLHAIDLRWGITEEETRRNRQLEVC LGEVENSQLFVGILGSRYGYIPPSYDLPDHPHFHWTHEYPSGRSVTEMEVMQ
DUF4062 |
 |
|---|
| PFAM accession number: | PF13271 |
|---|---|
| Interpro abstract (IPR025139): | This presumed domain is functionally uncharacterised. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4062