The domain within your query sequence starts at position 172 and ends at position 552; the E-value for the DUF4071 domain shown below is 2.1e-162.

LFYHLGVRESFSMANNIILYCDTNSDSLQSLKEIICQKNTVCTGNYTFIPYMVTPHNKVY
CCDSSFMKGLTELMQPNFELLLGPICLPLVDRFVQLLKVAQASSSQYFRESILSDIRKAR
NLYTGKELAAELARIRQRVDNIEVLTADIVINLLLSYRDIQDYDSIVKLVETLEKLPTFD
LASHHHVKFHYAFALNRRNLPGDRAKALDIMIPMVQSEEQVASDMYCLVGRIYKDMFLDS
NFTDTESRDHGASWFKKAFESEPTLQSGINYAVLLLAAGHQFESSFELRKVGVKLSSLLG
KKGNLEKLQSYWEVGFFLGASVLANDHLRVIQASEKLFRLKTPAWYLKSIVETILIYKHF
VKLTTEQPSAKQELVDFWMDF

DUF4071

DUF4071
PFAM accession number:PF13281
Interpro abstract (IPR025136):

This domain of unknown function is found at the N terminus of some mitogen-activated protein kinase kinase kinases, including MAP3K15, MAP3K5 and MAP3K6, which are components of protein kinase signal transduction cascades.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4071