The domain within your query sequence starts at position 36 and ends at position 124; the E-value for the DUF4147 domain shown below is 6.4e-17.

EQARQLFDSAVGAVQPGPMLQRTLSLDPSGRQLKVRDRTFQLRENLYLVGFGKAVLGMAA
AAEELLAQHLVQGVISVPKGIRAAMEHAG

DUF4147

DUF4147
PFAM accession number:PF13660
Interpro abstract (IPR025286):

This domain is frequently found at the N terminus of proteins that carrying the MOFRL domain (IPR007835), some of which are glycerate kinases [(PUBMED:20949620), (PUBMED:18156253)]. However, proteins matched by this entry do not have flavodoxin-like domain (IPR018193) or restriction-enzyme-like fold (IPR018197), which can be found in other type of glycerate kinases (IPR004381).

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4147