The domain within your query sequence starts at position 36 and ends at position 124; the E-value for the DUF4147 domain shown below is 6.4e-17.
EQARQLFDSAVGAVQPGPMLQRTLSLDPSGRQLKVRDRTFQLRENLYLVGFGKAVLGMAA AAEELLAQHLVQGVISVPKGIRAAMEHAG
DUF4147 |
---|
PFAM accession number: | PF13660 |
---|---|
Interpro abstract (IPR025286): | This domain is frequently found at the N terminus of proteins that carrying the MOFRL domain ( IPR007835 ), some of which are glycerate kinases [ (PUBMED:20949620) (PUBMED:18156253) ]. However, proteins matched by this entry do not have flavodoxin-like domain ( IPR018193 ) or restriction-enzyme-like fold ( IPR018197 ), which can be found in other type of glycerate kinases ( IPR004381 ). |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4147