The domain within your query sequence starts at position 17 and ends at position 119; the E-value for the DUF4149 domain shown below is 1.2e-27.

LVLSGAWGMQVWVTFISGFLLFRSLPRHTFGLVQSKVFPVYFHVSLGCAFINLCILAPQR
AWIHLTLWEVSQLSLLLLSLTLATINARWLEARTTAVMRALQS

DUF4149

DUF4149
PFAM accession number:PF13664
Interpro abstract (IPR025423): This presumed domain is functionally uncharacterised.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4149