The domain within your query sequence starts at position 107 and ends at position 232; the E-value for the DUF4171 domain shown below is 1.3e-55.
DTAMDLLKAITSPLAAGAKSSKKAGEKSSSSSSHPESRKEHHKKKGNGSSGELSLDDSNA HKSKKMKPLYVNTETLTLREPDGLKMKLILSPKEKGSSSVEEEAFQYPAQQASLKKPSKK LARDEQ
DUF4171 |
---|
PFAM accession number: | PF13775 |
---|---|
Interpro abstract (IPR025228): | The function of this domain is not known. It is often found at the N terminus of proteins that contain an HMG-box domain. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4171