The domain within your query sequence starts at position 247 and ends at position 368; the E-value for the DUF4174 domain shown below is 2.6e-30.
ALLDQFYEKRRLLIVSTPTARNLLYRLQLGMLQQAQCGLDLRHVTVVELVGVFPTLIGRI RAKIMPPALALQLRLLLRIPLYSFSMVVVDKHGMDKERYVSLVTPMALFNLIDTFPLRKE EM
DUF4174 |
---|
PFAM accession number: | PF13778 |
---|---|
Interpro abstract (IPR025232): | This domain of unknown function is found in a putative tumour suppressor gene [ (PUBMED:15563452) ] and in a ligand for the the urokinase-type plasminogen activator receptor, which plays a role in cellular migration and adhesion [ (PUBMED:18718938) (PUBMED:19667118) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4174