The domain within your query sequence starts at position 332 and ends at position 451; the E-value for the DUF4174 domain shown below is 4.3e-32.

LLDQFYEKRRLLIVSTPTARNLLYRLQLGMLQQAQCGLDLRHVTVVELVGVFPTLIGRIR
AKIMPPALALQLRLLLRIPLYSFSMVVVDKHGMDKERYVSLVTPMALFNLIDTFPLRKEE

DUF4174

DUF4174
PFAM accession number:PF13778
Interpro abstract (IPR025232):

This domain of unknown function is found in a putative tumour suppressor gene [ (PUBMED:15563452) ] and in a ligand for the the urokinase-type plasminogen activator receptor, which plays a role in cellular migration and adhesion [ (PUBMED:18718938) (PUBMED:19667118) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4174