The domain within your query sequence starts at position 769 and ends at position 902; the E-value for the DUF4174 domain shown below is 3.5e-39.

NFLSRFRWRRRLLVISAPNDEDWAYSQQLSALNGQACNFGLRHITILKLLGVGEEVGGVL
ELFPINGSSIVEREDVPAHLVKDIRNYFQVSPEYFSMLLVGKDGNVKSWYPSPMWSMVIV
YDLIDSMQLRRQEM

DUF4174

DUF4174
PFAM accession number:PF13778
Interpro abstract (IPR025232):

This domain of unknown function is found in a putative tumour suppressor gene [(PUBMED:15563452)] and in a ligand for the the urokinase-type plasminogen activator receptor, which plays a role in cellular migration and adhesion [(PUBMED:18718938), (PUBMED:19667118)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4174