The domain within your query sequence starts at position 56 and ends at position 234; the E-value for the DUF4195 domain shown below is 2.9e-85.
IFVGEISSSKPAISNILNRCSPGSSSKGLKNGSFNPAISNIFKPTSQHYRNPSSNALVAL PSFHPALKSSESSDGQTVSKLDFTKTSPQEDSGACSVSQSDSTQDIPSSNILQPRTGVDQ TLGLKHPSTSKVNSVNPKKPKTSASISETRPCSSSSSQTAPSGASSQTVLSNVNTSSVQ
DUF4195 |
---|
PFAM accession number: | PF13836 |
---|---|
Interpro abstract (IPR025243): | This domain is found at the N terminus of a number of proteins that carry PHD-like zinc-finger domains. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4195