The domain within your query sequence starts at position 44 and ends at position 162; the E-value for the DUF4200 domain shown below is 5.6e-30.
LLEKKKEAKIMQEAMEHKKEAFQRRMETLNLRWEELGIKEEQLKAHIQKFEQFIQENDQK RIRALKKANKERELKRLRLRELAKAKQEMMALRLEHQKLSVKLQDYAIFNKYLEKVVEN
DUF4200 |
---|
PFAM accession number: | PF13863 |
---|---|
Interpro abstract (IPR025252): | This entry represents a coiled-coil domain. Its function is unknown. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4200