The domain within your query sequence starts at position 42 and ends at position 241; the E-value for the DUF4203 domain shown below is 1.9e-56.

ALVCALCCCFGIIYCCFGYRCFKAVMFLSGLLSGALVIFLLCHKERVLETQLSLEVSAGI
ALGIGLLCGLVTMLVRSVGLFLTGLLLGLTLGVGTLLGTEPIYQPHSAWVPVGGLMGLAL
LGALLTLRWPRPFTVLGTALLGAAVLVACADYFLEGLALGTRLGERLQALPELLPLCWYS
WVLLGTWPVLGALGTLAQWK

DUF4203

DUF4203
PFAM accession number:PF13886
Interpro abstract (IPR025256): This domain of unknown function is often found in proteins from the transmembrane 7 superfamily.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4203