The domain within your query sequence starts at position 11 and ends at position 87; the E-value for the DUF4205 domain shown below is 3.7e-12.

LVWGTKSSPGLSDTIFCRWTQGFVFSESEGSALEQFEGGPCAVIAPVQAFLLKKLLFSSE
KSSWRDCSEKDHSELYQ

DUF4205

DUF4205
PFAM accession number:PF13898
Interpro abstract (IPR025257):

This is a conserved domain found in deubiquitinating enzymes, MINDY-3 and MINDY-4.

Deubiquitinating enzymes (DUBs) remove ubiquitin (Ub) from Ub-conjugated substrates to regulate the functional outcome of ubiquitylation. This entry includes MINDY-3/4. They belong to the MINDY (motif interacting with Ub-containing novel DUB) family (peptidase family C121), whose members are deubiquitinating enzymes releasing Lys48-linked ubiquitin [ (PUBMED:27292798) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4205