The domain within your query sequence starts at position 1470 and ends at position 1616; the E-value for the DUF4211 domain shown below is 1e-26.

EFSSSQSESSPEVRSSSSEDEGFEPPAPSVTRFLNTRAMKETFKSYMELLVSIALDPDTM
QALEKSNDELLLPHMKKIDGMLNDNRKRLLVNLHLDQPFKNALESFPELTVITRDSKAKS
GGSAISKIKMNGKAYNKKTLRTSKTTT

DUF4211

DUF4211
PFAM accession number:PF13926
Interpro abstract (IPR025451): This presumed domain is functionally uncharacterised.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4211