The domain within your query sequence starts at position 1817 and ends at position 1950; the E-value for the DUF4211 domain shown below is 6.5e-21.

SSSDSESSPGAPSEDERAVPGRLLKTRAMREMYRSYVEMLVSTALDPDMIQALEDTHDEL
YLPPMRKIDGLLNEHKKKVLKRLSLSPALQDALHTFPQLQVEQTGEGSPEEGAVRLRPAG
EPYNRKTLSKLKRS

DUF4211

DUF4211
PFAM accession number:PF13926
Interpro abstract (IPR025451): This presumed domain is functionally uncharacterised.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4211