The domain within your query sequence starts at position 13 and ends at position 94; the E-value for the DUF423 domain shown below is 5.7e-18.
VTTHSYGRGAQFPDAYGKELFDKANKHHFLHSLALLGVPSCRKPVWAGLLLASGTTLFCT SFYYQALSGDTSIQTLGPVGGS
DUF423 |
---|
PFAM accession number: | PF04241 |
---|---|
Interpro abstract (IPR006696): | This is a potential integral membrane protein with no known function. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF423