The domain within your query sequence starts at position 976 and ends at position 1020; the E-value for the DUF4339 domain shown below is 1.5e-18.

WYFGNADKERSGPYGFHEMQELWAKGMLNAKTRCWAQGMDGWRPL

DUF4339

DUF4339
PFAM accession number:PF14237
Interpro abstract (IPR025640):

This domain is functionally uncharacterised. There are two completely conserved residues (G and W) that may be functionally important.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4339