The domain within your query sequence starts at position 297 and ends at position 468; the E-value for the DUF4347 domain shown below is 1.4e-11.
AILISSRIPAYEMVMESIKPDVVAVLYEHSGVTLEGLLQLTDRALQGRKAQSLGIFSSGN SREIDLLQGYKICIKNVLWPEVRDFWEKLGSRVATEEEGGHVDLFVPLGASEAGIEVLSQ LSQLTGTWFSAPTGIATGSYQHILSDWLGPHQDRTPLSNYFSESKLQAWSSF
DUF4347 |
![]() |
---|
PFAM accession number: | PF14252 |
---|---|
Interpro abstract (IPR025592): | This uncharacterised domain contains two completely conserved residues (C and G) that may be functionally important. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4347