The domain within your query sequence starts at position 281 and ends at position 412; the E-value for the DUF4371 domain shown below is 1.6e-10.

AKDRVRVMIGDEFVTKLSAVSLSNDTVRRRIHDMSADILDQVVQEIKSAPLPICSIQLDE
STDVANCLQLMVYVRYINDGDFKDEFLCCKPLERTATALDVFEAVDSFLRQHEISWKSIC
GVCTDGAPATLG

DUF4371

DUF4371
PFAM accession number:PF14291
Interpro abstract (IPR025398): The function of this domain is not known.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4371