The domain within your query sequence starts at position 4 and ends at position 65; the E-value for the DUF4392 domain shown below is 9.6e-17.
GPSRRAGEQSWIQALPSVAKEEKMLGILVENQVRSGVSGIVGMEVDGLPFHDVHAEMIRK LV
DUF4392 |
---|
PFAM accession number: | PF14336 |
---|---|
Interpro abstract (IPR025504): | The function of this domain is not known There are two completely conserved G residues that may be functionally important. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4392