The domain within your query sequence starts at position 938 and ends at position 1071; the E-value for the DUF4414 domain shown below is 9.7e-11.

IDQSVLEALPLDLREQIEQVCAAQQGEPRGKKKEPVNGCSSGVLPHPVGTVLLQIPEPQE
PCNSDSKISVIALPAFSQVDPDVFAALPAELQKELKAAYDQRQRQGEDTTHQQPTSTSVP
KNPLLQLKPPAMKD

DUF4414

DUF4414
PFAM accession number:PF14377
Interpro abstract (IPR025527): The function of this domain is not known. It is often, though not always, found in DNA-binding ubiquitin ligases.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4414