SMART: Pfam domain DUF4430

The domain within your query sequence starts at position 340 and ends at position 416; the E-value for the DUF4430 domain shown below is 7.7e-9.

GSVLLAVLEEAQRKNSMFKFETTMTSWGLIVSSINNIAENVNHKTYWEFLSGKTPLDEGV
AYYIPFNHEHITANFTQ

DUF4430

PFAM accession number:	PF14478
Interpro abstract (IPR027954):	This domain of unknown function is found at the -terminus of transcobalamin, a vitamin B12-binding protein that transports cobalamin (vitamin B12) into cells [ (PUBMED:2777761) ]. This domain is also found in several uncharacterised proteins, like A0RGA8 that have an LPXTG-cell wall anchor at their C terminus, a polysaccharide lyase or glycosyltransferase structure associated with them in the middle region, as well as this domain at the N terminus.

PFAM accession number:

PF14478

Interpro abstract (IPR027954):

This domain of unknown function is found at the -terminus of transcobalamin, a vitamin B12-binding protein that transports cobalamin (vitamin B12) into cells [ (PUBMED:2777761) ].

This domain is also found in several uncharacterised proteins, like A0RGA8 that have an LPXTG-cell wall anchor at their C terminus, a polysaccharide lyase or glycosyltransferase structure associated with them in the middle region, as well as this domain at the N terminus.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4430