The domain within your query sequence starts at position 355 and ends at position 426; the E-value for the DUF4430 domain shown below is 7.9e-11.

GSSLEDVLKLAQDGGGFTYGTQASLSGPYLTSVLGKDAGDREYWQLLRAPDTPLLQGIAD
YKPQDGETIELR

DUF4430

DUF4430
PFAM accession number:PF14478
Interpro abstract (IPR027954):

This domain of unknown function is found at the -terminus of transcobalamin, a vitamin B12-binding protein that transports cobalamin (vitamin B12) into cells [(PUBMED:2777761)].

This domain is also found in several uncharacterised proteins, like A0RGA8, that have an LPXTG-cell wall anchor at their C terminus, a polysaccharide lyase or glycosyltransferase structure associated with them in the middle region, as well as this domain at the N terminus.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4430