The domain within your query sequence starts at position 390 and ends at position 504; the E-value for the DUF4440 domain shown below is 3.2e-14.

IIKITEQLIEAINNGDFEAYTKICDPGLTSFEPEALGNLVEGMDFHKFYFENLLSKNSKP
IHTTILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWLN

DUF4440

DUF4440
PFAM accession number:PF14534
Interpro abstract (IPR027843): This entry represents a domain of unknown function.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4440