The domain within your query sequence starts at position 61 and ends at position 175; the E-value for the DUF4440 domain shown below is 1e-12.
IIKVTEQLIEAISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLWSRNSKP VHTTILNPHIHLMGDESACIAYIRITQYLDAGGIPRTAQSEETRVWHRRDGKWQI
DUF4440 |
---|
PFAM accession number: | PF14534 |
---|---|
Interpro abstract (IPR027843): | This entry represents a domain of unknown function. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4440