The domain within your query sequence starts at position 733 and ends at position 863; the E-value for the DUF4457 domain shown below is 2.6e-31.

GEPVQISSITADPPDINILPAYGKDPRVVSNLIDGVNRTQDDMHVWLAPFTPGMTHTISI
EFTHPCQVALIRIWNYNKSRIHSFRGVKDITMLLDTQCIFEGEIAKASGTLMGAPEHFGD
TILFTMDEDIL

DUF4457

DUF4457
PFAM accession number:PF14652
Interpro abstract (IPR027859):

This domain is found in eukaryotic proteins. It is found repeated several times in the vertebrate KIAA0556 proteins.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4457