The domain within your query sequence starts at position 31 and ends at position 125; the E-value for the DUF4460 domain shown below is 2.7e-32.

LHYSRALSGAEAINALRPFYFAVHPDFFGQHPREREVNENSLKRLSVYLENLQKPGFKSL
KPTQLTFYIREKTAQNSSEGQEPISTTVCLLNTSK

DUF4460

DUF4460
PFAM accession number:PF14687
Interpro abstract (IPR028031):

This domain of unknown function has a conserved HPD sequence motif. There are two completely conserved residues (N and F) that may be functionally important. The domain is found in eukaryotic proteins, including T-cell activation inhibitor which may have a role in regulation of T cell activation or apoptosis [ (PUBMED:17456197) (PUBMED:19684086) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4460