The domain within your query sequence starts at position 33 and ends at position 144; the E-value for the DUF4460 domain shown below is 4.2e-40.
YSRALSGAEAINALRPFYFAVHPDFFGQHPREREVNENSLKRLSVYLENLQKPGFKSLKP TQLTFYIREKTAQNSSEGQEPISTTGFRAVRFTLHSSDLLSTVLYILNSCSL
DUF4460 |
---|
PFAM accession number: | PF14687 |
---|---|
Interpro abstract (IPR028031): | This domain of unknown function has a conserved HPD sequence motif. There are two completely conserved residues (N and F) that may be functionally important. The domain is found in eukaryotic proteins, including T-cell activation inhibitor which may have a role in regulation of T cell activation or apoptosis [ (PUBMED:17456197) (PUBMED:19684086) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4460