The domain within your query sequence starts at position 253 and ends at position 323; the E-value for the DUF4463 domain shown below is 6.1e-16.

FCYDVRNLIDLDDQRRHAMRGRLYYTAKAKKTGKVMIKTHPCSRLCFCKCWTCFKEVDAE
QYYSELEEQLT

DUF4463

DUF4463
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4463