The domain within your query sequence starts at position 16 and ends at position 122; the E-value for the DUF4470 domain shown below is 1.3e-27.

WWGLSPALDLQAESPPVDPDSQSKTERKVPELDALLLGSVDGRHMLRTLARAALWPLRSF
NFYVLENNLEAVARHMLIFSLALEEPEKMGLQERSETFLELWGNALL

DUF4470

DUF4470
PFAM accession number:PF14737
Interpro abstract (IPR027974):

This domain of unknown function is conserved from fungi to Metazoa and plants. It is sometimes found in proteins that have a zinc-finger domain, zf-MYND at their very C terminus. In other cases it is associated with as in axonemal dynein assembly factor 3 [(PUBMED:22387996)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4470