The domain within your query sequence starts at position 154 and ends at position 436; the E-value for the DUF4471 domain shown below is 5.3e-104.

LSLRLLKFRERDALEAVFRFWSGGEKGPEVFPMSRLWDSRLRHYLGSRYDARRGVADWDL
RMKLHDRGAQVIHIQEFRRWRDTGVAFELRDLSAYHVPNRTLASGRLLSHRGERVAARGY
WGDIATGPFMAFGIEADDQSLLRTRNGQPVKTASEITQHNVTELFREVAAWRGPRAIQGN
VEETESPEPDVPAQEPFTIHFLPLDSSQTLHHKTCYQGRFQLLYVSCGMVHLLSPELGAC
VAPGGNLVVELARYLVDLRPKELKAFSDRVVEIARVAGFAPHT

DUF4471

DUF4471
PFAM accession number:PF14740
Interpro abstract (IPR028235): This domain of unknown function is found in a number of proteins, including dynein assembly factor 3 (DNAAF3), which is required for the assembly of axonemal inner and outer dynein arms. DNAAF3 is involved in preassembly of dyneins into complexes before their transport into cilia [(PUBMED:22387996)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4471