The domain within your query sequence starts at position 38 and ends at position 159; the E-value for the DUF4481 domain shown below is 6.5e-55.
LHNGQVLTVLRIDNTCAPISFDLGAAEEQLQAWGIQVPAEQYRNLAESALLEPQVRRYII YNSRPMRLAFAVVFYVLVWANIYSTSQMFALGNQWAGVLLATLAAFSLTLTLVLVFERQQ RK
DUF4481 |
---|
PFAM accession number: | PF14800 |
---|---|
Interpro abstract (IPR028054): | This family of unknown function is found in eukaryotes. The human representative is transmembrane protein C9orf91. In mouse it is also known as Tmem268. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4481