The domain within your query sequence starts at position 39 and ends at position 328; the E-value for the DUF4481 domain shown below is 4.2e-130.

HNGQVLTVLRIDNTCAPISFDLGAAEEQLQAWGIQVPAEQYRNLAESALLEPQVRRYIIY
NSRPMRLAFAVVFYVLVWANIYSTSQMFALGNQWAGVLLATLAAFSLTLTLVLVFERQQR
KANTNTDLRLVAANGALLRHRVLLGVTDTVEGCQSVIQLWFVYFDLENCVQFLSDHVQEM
KRSQESLLRSRLSQLCVVMETGVSPVVEGPEDLEDAPLLPSTPGPQERPLTQTELYQLVP
EAEPEEMARQLLAVFGGYYTRLLVTSRLPQSMGTRHMDSARIPCPCQLIE

DUF4481

DUF4481
PFAM accession number:PF14800
Interpro abstract (IPR028054): This family of unknown function is found in eukaryotes. The human representative is transmembrane protein C9orf91. In mouse it is also known as Tmem268.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4481