The domain within your query sequence starts at position 54 and ends at position 204; the E-value for the DUF4483 domain shown below is 1.1e-53.
RDSMFQNPLIVKAELGKPRERSCSLPGINFNYGLYIRGLDGGVPEAIGHWNVFKQQPTCP HELTRNYIAMNRGAVKAGLVTARENMLYRELNDIRINDQEDRRQKEPPPIPPNMTFGIRS RPSTPFFDLLQHRYQQLWVQEQKATQQAIKM
DUF4483 |
---|
PFAM accession number: | PF14825 |
---|---|
Interpro abstract (IPR029147): | Proteins in this entry have been found in flagella [ (PUBMED:15998802) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4483