The domain within your query sequence starts at position 103 and ends at position 148; the E-value for the DUF4486 domain shown below is 4.3e-22.

QKYEFHRRCATTLFNIWTKYAPRLPSNYYNEKLLKVGDSLCQIKFH

DUF4486

 DUF4486
PFAM accession number:PF14858
Interpro abstract (IPR027912):

CFAP54 is required for assembly and function of cilia and flagella [ (PUBMED:26224312) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4486