The domain within your query sequence starts at position 103 and ends at position 643; the E-value for the DUF4486 domain shown below is 3e-298.

QKYEFHRRCATTLFNIWTKYAPRLPSNYYNEKLLKVGDSLCQIKEYKLALLQCYGRYLQE
FIADFDEHKEDVNHFKTVFFPKGFGDETARLTFHALSGKNICNYQLVCESDANLQNEESV
RQCLHILSSFRLIMQVALPQEHLCWIIFNGTLYIYTICRKLMVIGQSSKALEFLLWASMC
MESSVPLLSIRYLTWRATLYTAVCQCHYDCQDGIHGEAFARRALAKIDELRQLELMSSSS
SLETSRKYYREATIKMAVMIFKRGVFESRRKNKNVLRPKLRLNLKEAQSLPWPRTVTERL
LDELLDSTSSRFLAVLEALSDSNRRILQTGPLVTDEMELRDVVSELFMAGKELLILSNVR
SNGKLDFPQTSLLEHVVEKRNALSVGASVRFAKLAFTYEEWGLFESLAGQLIHFLQKQDN
PQSKKAEKDLILLLAVEPLINVKRNRGLIFPLETDKETQSIENYLKHIACHESCMRTTFT
EDTFSLAAILHFCVCVPTQGVLPDKDIVVDIIGLLWQRCKLGIQRLNIPKNDFAKYSHKI
S

DUF4486

DUF4486
PFAM accession number:PF14858
Interpro abstract (IPR027912): CFAP54 is required for assembly and function of cilia and flagella [(PUBMED:26224312)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4486